Lineage for d4f3ja1 (4f3j A:103-243)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777600Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2777601Domain d4f3ja1: 4f3j A:103-243 [194367]
    Other proteins in same PDB: d4f3ja2, d4f3ja3
    automated match to d1c3ha_

Details for d4f3ja1

PDB Entry: 4f3j (more details), 1.34 Å

PDB Description: Crystal Structure of Trimeric gC1q Domain of Human C1QTNF5 associated with Late-onset Retinal Macular Degeneration
PDB Compounds: (A:) Complement C1q tumor necrosis factor-related protein 5

SCOPe Domain Sequences for d4f3ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f3ja1 b.22.1.0 (A:103-243) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsafsakrsesrvpppsdaplpfdrvlvneqghydavtgkftcqvpgvyyfavhatvyra
slqfdlvkngesiasffqffggwpkpaslsggamvrlepedqvwvqvgvgdyigiyasik
tdstfsgflvysdwhsspvfa

SCOPe Domain Coordinates for d4f3ja1:

Click to download the PDB-style file with coordinates for d4f3ja1.
(The format of our PDB-style files is described here.)

Timeline for d4f3ja1: