Lineage for d4equa_ (4equ A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221476Protein automated matches [190091] (10 species)
    not a true protein
  7. 1221539Species Homo sapiens [TaxId:9606] [192729] (55 PDB entries)
  8. 1221565Domain d4equa_: 4equ A: [194366]
    automated match to d2j7ta_
    complexed with 1pe, ca, g6i

Details for d4equa_

PDB Entry: 4equ (more details), 2 Å

PDB Description: Human STK-10 (LOK) kinase domain in DFG-out conformation with inhibitor DSA-7
PDB Compounds: (A:) serine/threonine-protein kinase 10

SCOPe Domain Sequences for d4equa_:

Sequence, based on SEQRES records: (download)

>d4equa_ d.144.1.7 (A:) automated matches {Homo sapiens [TaxId: 9606]}
ehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeeledyiveie
ilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmle
alnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigtpywmapev
vmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskw
svefrdflkialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevmee

Sequence, based on observed residues (ATOM records): (download)

>d4equa_ d.144.1.7 (A:) automated matches {Homo sapiens [TaxId: 9606]}
ehvrrdldpnevweivgelgkvykaknketgalaaakvieledyiveieilatcdhpyiv
kllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmlealnflhskrii
hrdlkagnvlmtlegdirladfgvsaknligtpywmapevvmcetmkdtpydykadiwsl
gitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdflkialdknpetrp
saaqllehpfvssitsnkalrelvaeakaevmee

SCOPe Domain Coordinates for d4equa_:

Click to download the PDB-style file with coordinates for d4equa_.
(The format of our PDB-style files is described here.)

Timeline for d4equa_: