Lineage for d4esac_ (4esa C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1074991Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1076761Protein automated matches [190359] (36 species)
    not a true protein
  7. 1076903Species Eleginops maclovinus [TaxId:56733] [193401] (1 PDB entry)
  8. 1076905Domain d4esac_: 4esa C: [194364]
    automated match to d2h8fa_
    complexed with cmo, gol, hem

Details for d4esac_

PDB Entry: 4esa (more details), 1.45 Å

PDB Description: x-ray structure of carbonmonoxy hemoglobin of eleginops maclovinus
PDB Compounds: (C:) hemoglobin alpha chain

SCOPe Domain Sequences for d4esac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4esac_ a.1.1.2 (C:) automated matches {Eleginops maclovinus [TaxId: 56733]}
slsdkdkaavkllwskiskssdaigndalsrmivvypqtktyfahwpdlspgsphvkahg
ktvmggialavskiddlraglldlseqhayklrvdpanfkilshcilvvismmfpkeftp
eahvsldkflsgvslalseryr

SCOPe Domain Coordinates for d4esac_:

Click to download the PDB-style file with coordinates for d4esac_.
(The format of our PDB-style files is described here.)

Timeline for d4esac_: