Lineage for d4esaa_ (4esa A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688649Species Eleginops maclovinus [TaxId:56733] [193401] (2 PDB entries)
  8. 2688650Domain d4esaa_: 4esa A: [194363]
    automated match to d2h8fa_
    complexed with cmo, gol, hem

Details for d4esaa_

PDB Entry: 4esa (more details), 1.45 Å

PDB Description: x-ray structure of carbonmonoxy hemoglobin of eleginops maclovinus
PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d4esaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4esaa_ a.1.1.2 (A:) automated matches {Eleginops maclovinus [TaxId: 56733]}
slsdkdkaavkllwskiskssdaigndalsrmivvypqtktyfahwpdlspgsphvkahg
ktvmggialavskiddlraglldlseqhayklrvdpanfkilshcilvvismmfpkeftp
eahvsldkflsgvslalseryr

SCOPe Domain Coordinates for d4esaa_:

Click to download the PDB-style file with coordinates for d4esaa_.
(The format of our PDB-style files is described here.)

Timeline for d4esaa_: