Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein automated matches [190169] (7 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187524] (12 PDB entries) |
Domain d4gaca_: 4gac A: [194361] automated match to d2alra_ complexed with edo, flc |
PDB Entry: 4gac (more details), 1.64 Å
SCOPe Domain Sequences for d4gaca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gaca_ c.1.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tassvllhtgqkmpliglgtwksepgqvkaaikhalsagyrhidcasvygneteigealk esvgsgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyaferg dnpfpknadgtvrydsthyketwkalevlvakglvkalglsnfnsrqiddvlsvasvrpa vlqvechpylaqneliahcharglevtaysplgssdrawrhpdepvlleepvvlalaekh grspaqillrwqvqrkvicipksinpsrilqniqvfdftfspeemkqldalnknwryivp mitvdgkrvprdaghplypfndpy
Timeline for d4gaca_: