SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4gaca_ (4gac A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2081255Protein automated matches [190169] (5 species)
    not a true protein
  7. 2081331Species Mouse (Mus musculus) [TaxId:10090] [187524] (12 PDB entries)
  8. 2081335Domain d4gaca_: 4gac A: [194361]
    automated match to d2alra_
    complexed with edo, flc

Details for d4gaca_

PDB Entry: 4gac (more details), 1.64 Å

PDB Description: High resolution structure of mouse aldehyde reductase (AKR1a4) in its apo-form
PDB Compounds: (A:) Alcohol dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d4gaca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gaca_ c.1.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tassvllhtgqkmpliglgtwksepgqvkaaikhalsagyrhidcasvygneteigealk
esvgsgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyaferg
dnpfpknadgtvrydsthyketwkalevlvakglvkalglsnfnsrqiddvlsvasvrpa
vlqvechpylaqneliahcharglevtaysplgssdrawrhpdepvlleepvvlalaekh
grspaqillrwqvqrkvicipksinpsrilqniqvfdftfspeemkqldalnknwryivp
mitvdgkrvprdaghplypfndpy

SCOPe Domain Coordinates for d4gaca_:

Click to download the PDB-style file with coordinates for d4gaca_.
(The format of our PDB-style files is described here.)

Timeline for d4gaca_: