Lineage for d4gacb_ (4gac B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2081255Protein automated matches [190169] (5 species)
    not a true protein
  7. 2081331Species Mouse (Mus musculus) [TaxId:10090] [187524] (12 PDB entries)
  8. 2081336Domain d4gacb_: 4gac B: [194360]
    automated match to d2alra_
    complexed with edo, flc

Details for d4gacb_

PDB Entry: 4gac (more details), 1.64 Å

PDB Description: high resolution structure of mouse aldehyde reductase (akr1a4) in its apo-form
PDB Compounds: (B:) Alcohol dehydrogenase [NADP(+)]

SCOPe Domain Sequences for d4gacb_:

Sequence, based on SEQRES records: (download)

>d4gacb_ c.1.7.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvllhtgqkmpliglgtwksepgqvkaaikhalsagyrhidcasvygneteigealke
svgsgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyafergd
npfpknadgtvrydsthyketwkalevlvakglvkalglsnfnsrqiddvlsvasvrpav
lqvechpylaqneliahcharglevtaysplgssdrawrhpdepvlleepvvlalaekhg
rspaqillrwqvqrkvicipksinpsrilqniqvfdftfspeemkqldalnknwryivpm
itvdgkrvprdaghplypfndpy

Sequence, based on observed residues (ATOM records): (download)

>d4gacb_ c.1.7.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
assvllhtgqkmpliglgtwksepgqvkaaikhalsagyrhidcasvygneteigealke
svgsgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyafergd
npfpkgtvrydsthyketwkalevlvakglvkalglsnfnsrqiddvlsvasvrpavlqv
echpylaqneliahcharglevtaysplgpdepvlleepvvlalaekhgrspaqillrwq
vqrkvicipksinpsrilqniqvfdftfspeemkqldalnknwryivpmvprdaghplyp
fndpy

SCOPe Domain Coordinates for d4gacb_:

Click to download the PDB-style file with coordinates for d4gacb_.
(The format of our PDB-style files is described here.)

Timeline for d4gacb_: