Lineage for d1fps__ (1fps -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6574Fold a.128: Terpenoid synthases [48575] (1 superfamily)
  4. 6575Superfamily a.128.1: Terpenoid synthases [48576] (4 families) (S)
  5. 6576Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (1 protein)
  6. 6577Protein Farnesyl diphosphate synthase [48578] (1 species)
  7. 6578Species Chicken (Gallus gallus) [TaxId:9031] [48579] (5 PDB entries)
  8. 6580Domain d1fps__: 1fps - [19436]

Details for d1fps__

PDB Entry: 1fps (more details), 2.6 Å

PDB Description: crystal structure of recombinant farnesyl diphosphate synthase at 2.6 angstroms resolution

SCOP Domain Sequences for d1fps__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fps__ a.128.1.1 (-) Farnesyl diphosphate synthase {Chicken (Gallus gallus)}
spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
aayrelsgpgqkdaeslrcalavgwcielfqafflvaddimdqsltrrgqlcwykkegvg
ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
ldcfgdpaltgkvgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk

SCOP Domain Coordinates for d1fps__:

Click to download the PDB-style file with coordinates for d1fps__.
(The format of our PDB-style files is described here.)

Timeline for d1fps__: