SCOPe 2.08: Domain d4hgab_: 4hga B:

Lineage for d4hgab_ (4hga B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)

8. Domain d4hgab_: 4hga B: [194356]
   Other proteins in same PDB: d4hgac_
   automated match to d1kx5a_
   complexed with pc4

Details for d4hgab_

PDB Entry: 4hga, 2.8 Å

PDB Description: Structure of the variant histone H3.3-H4 heterodimer in complex with its chaperone DAXX

PDB Compounds: (B:) Histone H3.3

SCOPe Domain Sequences for d4hgab_:

Sequence; same for both SEQRES and ATOM records:

>d4hgab_ a.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqsaaigalqeaseaylvg
lfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d4hgab_:

• d4hgab_ first appeared in SCOPe 2.02
  
• d4hgab_ appears in SCOPe 2.07