SCOPe 2.08: Domain d3ui6a1: 3ui6 A:36-131

Lineage for d3ui6a1 (3ui6 A:36-131)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (61 PDB entries)

8. Domain d3ui6a1: 3ui6 A:36-131 [194351]
   Other proteins in same PDB: d3ui6a2
   automated match to d3ui4a_
   complexed with d1d, na, so4

Details for d3ui6a1

PDB Entry: 3ui6, 0.89 Å

PDB Description: 0.89 a resolution crystal structure of human parvulin 14 in complex with oxidized dtt

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4

SCOPe Domain Sequences for d3ui6a1:

Sequence; same for both SEQRES and ATOM records:

>d3ui6a1 d.26.1.1 (A:36-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
navkvrhilcekhgkimeameklksgmrfnevaaqysedkarqggdlgwmtrgsmvgpfq
eaafalpvsgmdkpvftdppvktkfgyhiimvegrk

Timeline for d3ui6a1:

• d3ui6a1 first appeared in SCOPe 2.02, called d3ui6a_
  
• d3ui6a1 appears in SCOPe 2.07