Lineage for d1ubya_ (1uby A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731438Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2731439Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)
  7. 2731440Species Chicken (Gallus gallus) [TaxId:9031] [48579] (5 PDB entries)
  8. 2731441Domain d1ubya_: 1uby A: [19435]
    complexed with dma, mg

Details for d1ubya_

PDB Entry: 1uby (more details), 2.4 Å

PDB Description: structure of farnesyl pyrophosphate synthetase
PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d1ubya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubya_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]}
spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
aayrelsgpgqkdaeslrcalavgwcielfqaaslvaddimdqsltrrgqlcwykkegvg
ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
ldcfgdpaltgavgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk

SCOPe Domain Coordinates for d1ubya_:

Click to download the PDB-style file with coordinates for d1ubya_.
(The format of our PDB-style files is described here.)

Timeline for d1ubya_: