SCOPe 2.08: Domain d1ubya_: 1uby A:

Lineage for d1ubya_ (1uby A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [48579] (5 PDB entries)

8. Domain d1ubya_: 1uby A: [19435]
   complexed with dma, mg

Details for d1ubya_

PDB Entry: 1uby, 2.4 Å

PDB Description: structure of farnesyl pyrophosphate synthetase

PDB Compounds: (A:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d1ubya_:

Sequence; same for both SEQRES and ATOM records:

>d1ubya_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Chicken (Gallus gallus) [TaxId: 9031]}
spvvverereefvgffpqivrdltedgighpevgdavarlkevlqynapggkcnrgltvv
aayrelsgpgqkdaeslrcalavgwcielfqaaslvaddimdqsltrrgqlcwykkegvg
ldaindsfllessvyrvlkkycrqrpyyvhllelflqtayqtelgqmldlitapvskvdl
shfseerykaivkyktafysfylpvaaamymvgidskeehenakaillemgeyfqiqddy
ldcfgdpaltgavgtdiqdnkcswlvvqclqrvtpeqrqllednygrkepekvakvkely
eavgmraafqqyeessyrrlqeliekhsnrlpkeiflglaqkiykrqk

Timeline for d1ubya_:

• d1ubya_ first appeared (with stable ids) in SCOP 1.55, called d1uby__
  
• d1ubya_ appears in SCOPe 2.07