Lineage for d3vrfa_ (3vrf A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717797Protein automated matches [190359] (40 species)
    not a true protein
  7. 1718022Species Mammuthus primigenius [TaxId:37349] [194337] (3 PDB entries)
  8. 1718025Domain d3vrfa_: 3vrf A: [194344]
    automated match to d1bz1a_
    complexed with cmo, hem

Details for d3vrfa_

PDB Entry: 3vrf (more details), 1.55 Å

PDB Description: the crystal structure of hemoglobin from woolly mammoth in the carbonmonoxy forms
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3vrfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vrfa_ a.1.1.2 (A:) automated matches {Mammuthus primigenius [TaxId: 37349]}
vlsdndktnvkatwskvgdhasdyvaealermffsfpttktyfphfdlshgsgqvkghgk
kvgealtqavghlddlpsalsalsdlhahklrvdpvnfkllshcllvtlsshqpteftpe
vhasldkflsnvstvltskyr

SCOPe Domain Coordinates for d3vrfa_:

Click to download the PDB-style file with coordinates for d3vrfa_.
(The format of our PDB-style files is described here.)

Timeline for d3vrfa_: