SCOPe 2.02: Domain d3vrgb_: 3vrg B:

Lineage for d3vrgb_ (3vrg B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (36 species)
   not a true protein

7. Species Mammuthus primigenius [TaxId:37349] [194337] (3 PDB entries)

8. Domain d3vrgb_: 3vrg B: [194343]
   automated match to d2raob_
   complexed with hem, so4

Details for d3vrgb_

PDB Entry: 3vrg, 1.5 Å

PDB Description: the crystal structure of hemoglobin from woolly mammoth in the met form

PDB Compounds: (B:) Hemoglobin subunit beta/delta hybrid

SCOPe Domain Sequences for d3vrgb_:

Sequence; same for both SEQRES and ATOM records:

>d3vrgb_ a.1.1.2 (B:) automated matches {Mammuthus primigenius [TaxId: 37349]}
vnltaaektqvanlwgkvnvkelggealsrllvvypwtrrffehfgdlstadavlhnakv
lahgekvltsfgeglkhldnlkgtfsdlselhcdklhvdpqnfrllgnvlvivlarhfgk
eftpdvqaayekvvagvanalahkyh

Timeline for d3vrgb_:

• d3vrgb_ is new in SCOPe 2.02-stable
  
• d3vrgb_ appears in SCOPe 2.03
  
• d3vrgb_ appears in the current release, SCOPe 2.08