![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Mammuthus primigenius [TaxId:37349] [194337] (3 PDB entries) |
![]() | Domain d3vrgb_: 3vrg B: [194343] automated match to d2raob_ complexed with hem, so4 |
PDB Entry: 3vrg (more details), 1.5 Å
SCOPe Domain Sequences for d3vrgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vrgb_ a.1.1.2 (B:) automated matches {Mammuthus primigenius [TaxId: 37349]} vnltaaektqvanlwgkvnvkelggealsrllvvypwtrrffehfgdlstadavlhnakv lahgekvltsfgeglkhldnlkgtfsdlselhcdklhvdpqnfrllgnvlvivlarhfgk eftpdvqaayekvvagvanalahkyh
Timeline for d3vrgb_: