Lineage for d1b8fa_ (1b8f A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777280Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 777281Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 777383Family a.127.1.2: HAL/PAL-like [48572] (2 proteins)
    Pfam PF00221
  6. 777384Protein Histidine ammonia-lyase (HAL) [48573] (1 species)
  7. 777385Species Pseudomonas putida [TaxId:303] [48574] (6 PDB entries)
  8. 777393Domain d1b8fa_: 1b8f A: [19434]
    complexed with gol, so4; mutant

Details for d1b8fa_

PDB Entry: 1b8f (more details), 2.1 Å

PDB Description: histidine ammonia-lyase (hal) from pseudomonas putida
PDB Compounds: (A:) histidine ammonia-lyase

SCOP Domain Sequences for d1b8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8fa_ a.127.1.2 (A:) Histidine ammonia-lyase (HAL) {Pseudomonas putida [TaxId: 303]}
teltlkpgtltlaqlraihaapvrlqldasaapaidasvacveqiiaedrtaygintgfg
llastriashdlenlqrslvlshaagigapldddlvrlimvlkinslsrgfsgirrkvid
alialvnaevyphiplkgsvgasgdlaplahmslvllgegkarykgqwlsatealavagl
epltlaakeglallngtqastayalrglfyaedlyaaaiacgglsveavlgsrspfdari
heargqrgqidtaacfrdllgdssevslshknadkvqdpyslrcqpqvmgacltqlrqaa
evlgieanavsdnplvfaaegdvisggnfhaepvamaadnlalaiaeigslserrislmm
dkhmsqlppflvenggvnsgfmiaqvtaaalasenkalshphsvdslptsanqedhvsma
paagkrlwemaentrgvlaiewlgacqgldlrkglktsaklekarqalrsevahydrdrf
fapdiekavellakgsltgllpagvlpsl

SCOP Domain Coordinates for d1b8fa_:

Click to download the PDB-style file with coordinates for d1b8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1b8fa_: