SCOPe 2.04: Domain d3vred_: 3vre D:

Lineage for d3vred_ (3vre D:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (38 species)
   not a true protein

7. Species Mammuthus primigenius [TaxId:37349] [194337] (3 PDB entries)

8. Domain d3vred_: 3vre D: [194339]
   automated match to d2raob_
   complexed with hem

Details for d3vred_

PDB Entry: 3vre, 2.2 Å

PDB Description: The crystal structure of hemoglobin from woolly mammoth in the deoxy form

PDB Compounds: (D:) Hemoglobin subunit beta/delta hybrid

SCOPe Domain Sequences for d3vred_:

Sequence; same for both SEQRES and ATOM records:

>d3vred_ a.1.1.2 (D:) automated matches {Mammuthus primigenius [TaxId: 37349]}
vnltaaektqvanlwgkvnvkelggealsrllvvypwtrrffehfgdlstadavlhnakv
lahgekvltsfgeglkhldnlkgtfsdlselhcdklhvdpqnfrllgnvlvivlarhfgk
eftpdvqaayekvvagvanalahkyh

Timeline for d3vred_:

• d3vred_ first appeared in SCOPe 2.02
  
• d3vred_ appears in SCOPe 2.03
  
• d3vred_ appears in SCOPe 2.05
  
• d3vred_ appears in the current release, SCOPe 2.08