Lineage for d2ypga_ (2ypg A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040427Domain d2ypga_: 2ypg A: [194334]
    Other proteins in same PDB: d2ypgb_, d2ypgd_, d2ypgf_
    automated match to d1hgea_
    complexed with flc, nag

Details for d2ypga_

PDB Entry: 2ypg (more details), 2.85 Å

PDB Description: Haemagglutinin of 1968 Human H3N2 Virus in Complex with Human Receptor Analogue LSTc
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d2ypga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ypga_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
vkqntlklatgmrnvpe

SCOPe Domain Coordinates for d2ypga_:

Click to download the PDB-style file with coordinates for d2ypga_.
(The format of our PDB-style files is described here.)

Timeline for d2ypga_: