Lineage for d2ekcb_ (2ekc B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079795Species Aquifex aeolicus [TaxId:224324] [194332] (1 PDB entry)
  8. 2079797Domain d2ekcb_: 2ekc B: [194333]
    automated match to d1wxja_

Details for d2ekcb_

PDB Entry: 2ekc (more details), 2 Å

PDB Description: Structural study of Project ID aq_1548 from Aquifex aeolicus VF5
PDB Compounds: (B:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d2ekcb_:

Sequence, based on SEQRES records: (download)

>d2ekcb_ c.1.2.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
grisdkftelkekrekalvsylmvgypdyetslkafkevlkngtdileigfpfsdpvadg
ptiqvahevalkngirfedvlelsetlrkefpdipfllmtyynpifriglekfcrlsrek
gidgfivpdlppeeaeelkavmkkyvlsfvplgaptstrkrikliceaademtyfvsvtg
ttgareklpyerikkkveeyrelcdkpvvvgfgvskkehareigsfadgvvvgsalvkla
gqkkiedlgnlvkelkeglre

Sequence, based on observed residues (ATOM records): (download)

>d2ekcb_ c.1.2.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
grisdkftelkekrekalvsylmvgypdyetslkafkevlkngtdileigfpfsdpvadg
ptiqvahevalkngirfedvlelsetlrkefpdipfllmtyynpifriglekfcrlsrek
gidgfivpdlppeeaeelkavmkkyvlsfvplgaptstrkrikliceaademtyfvsvga
reklpyerikkkveeyrelcdkpvvvgfgvskkehareigsfadgvvvgsalvklagqkk
iedlgnlvkelkeglre

SCOPe Domain Coordinates for d2ekcb_:

Click to download the PDB-style file with coordinates for d2ekcb_.
(The format of our PDB-style files is described here.)

Timeline for d2ekcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ekca_