Lineage for d4b6ga_ (4b6g A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178944Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1178945Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1180576Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1180577Protein automated matches [190543] (24 species)
    not a true protein
  7. 1180655Species Neisseria meningitidis [TaxId:122586] [194329] (1 PDB entry)
  8. 1180656Domain d4b6ga_: 4b6g A: [194331]
    automated match to d3fcxa_

Details for d4b6ga_

PDB Entry: 4b6g (more details), 1.4 Å

PDB Description: the crystal structure of the neisserial esterase d.
PDB Compounds: (A:) Putative Esterase

SCOPe Domain Sequences for d4b6ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b6ga_ c.69.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}
enlyfqgamelieqhqifggsqqvwahhaqtlqcemkfavylpnnpenrplgviywlsgl
tcteqnfitksgfqryaaehqvivvapdtsprgeqvpnddaydlgqsagfylnateqpwa
anyqmydyilnelprliekhfptngkrsimghsmgghgalvlalrnqeryqsvsafspil
spslvpwgekaftaylgkdrekwqqydansliqqgykvqgmridqgledeflptqlrted
fietcraanqpvdvrfhkgydhsyyfiasfigehiayhaaflk

SCOPe Domain Coordinates for d4b6ga_:

Click to download the PDB-style file with coordinates for d4b6ga_.
(The format of our PDB-style files is described here.)

Timeline for d4b6ga_:

  • d4b6ga_ appears in periodic updates to SCOPe 2.02 starting on 2013-05-28
  • d4b6ga_ appears in SCOPe 2.03
  • d4b6ga_ appears in the current release, SCOPe 2.07, called d4b6ga1

View in 3D
Domains from other chains:
(mouse over for more information)
d4b6gb_