Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Neisseria meningitidis [TaxId:122586] [194329] (1 PDB entry) |
Domain d4b6gb1: 4b6g B:3-275 [194330] Other proteins in same PDB: d4b6ga2, d4b6gb2 automated match to d3fcxa_ |
PDB Entry: 4b6g (more details), 1.4 Å
SCOPe Domain Sequences for d4b6gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b6gb1 c.69.1.0 (B:3-275) automated matches {Neisseria meningitidis [TaxId: 122586]} lieqhqifggsqqvwahhaqtlqcemkfavylpnnpenrplgviywlsgltcteqnfitk sgfqryaaehqvivvapdtsprgeqvpnddaydlgqsagfylnateqpwaanyqmydyil nelprliekhfptngkrsimghsmgghgalvlalrnqeryqsvsafspilspslvpwgek aftaylgkdrekwqqydansliqqgykvqgmridqgledeflptqlrtedfietcraanq pvdvrfhkgydhsyyfiasfigehiayhaaflk
Timeline for d4b6gb1: