Lineage for d4b6gb1 (4b6g B:3-275)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153173Species Neisseria meningitidis [TaxId:122586] [194329] (1 PDB entry)
  8. 2153175Domain d4b6gb1: 4b6g B:3-275 [194330]
    Other proteins in same PDB: d4b6ga2, d4b6gb2
    automated match to d3fcxa_

Details for d4b6gb1

PDB Entry: 4b6g (more details), 1.4 Å

PDB Description: the crystal structure of the neisserial esterase d.
PDB Compounds: (B:) Putative Esterase

SCOPe Domain Sequences for d4b6gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b6gb1 c.69.1.0 (B:3-275) automated matches {Neisseria meningitidis [TaxId: 122586]}
lieqhqifggsqqvwahhaqtlqcemkfavylpnnpenrplgviywlsgltcteqnfitk
sgfqryaaehqvivvapdtsprgeqvpnddaydlgqsagfylnateqpwaanyqmydyil
nelprliekhfptngkrsimghsmgghgalvlalrnqeryqsvsafspilspslvpwgek
aftaylgkdrekwqqydansliqqgykvqgmridqgledeflptqlrtedfietcraanq
pvdvrfhkgydhsyyfiasfigehiayhaaflk

SCOPe Domain Coordinates for d4b6gb1:

Click to download the PDB-style file with coordinates for d4b6gb1.
(The format of our PDB-style files is described here.)

Timeline for d4b6gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4b6gb2