Lineage for d1f1oa_ (1f1o A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6519Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 6520Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 6521Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 6522Protein Adenylosuccinate lyase [48568] (3 species)
  7. 6523Species Bacillus subtilis [TaxId:1423] [48571] (1 PDB entry)
  8. 6524Domain d1f1oa_: 1f1o A: [19433]

Details for d1f1oa_

PDB Entry: 1f1o (more details), 3.25 Å

PDB Description: structural studies of adenylosuccinate lyases

SCOP Domain Sequences for d1f1oa_:

Sequence, based on SEQRES records: (download)

>d1f1oa_ a.127.1.1 (A:) Adenylosuccinate lyase {Bacillus subtilis}
emsaiwtdenrfqawleveilaceawaelgvipkedvkvmrenasfdinrileiekdtrh
dvvaftravseslgeerkwvhygltstdvvdtalsyllkqandillkdlerfvdiikeka
kehkytvmmgrthgvhaepttfglklalwheemkrnlerfkqakagievgkisgavgtya
nidpfveqyvceklglkaapistqtlqrdrhadymatlaliatsiekfaveirglqkset
reveeffakgqkgssamphkrnpigsenmtgmarvirgymmtayenvplwherdishssa
eriilpdatialnymlnrfsnivknltvfpenmkrnmdrtlgliysqrvllalidtgltr
eeaydtvqpkameawekqvpfrelveaeekitsrlspekiadcfdyny

Sequence, based on observed residues (ATOM records): (download)

>d1f1oa_ a.127.1.1 (A:) Adenylosuccinate lyase {Bacillus subtilis}
emsaiwtdenrfqawleveilaceawaelgvipkedvkvmrenasfdinrileiekdtrh
dvvaftravseslgeerkwvhygltstdvvdtalsyllkqandillkdlerfvdiikeka
kehkytvmmthgvhaepttfglklalwheemkrnlerfkqakagievgkisgnidpfveq
yvceklglkaapistqtlqrdrhadymatlaliatsiekfaveirglqksetreveefsa
mphkrnpigsenmtgmarvirgymmtayenvplwherdishssaeriilpdatialnyml
nrfsnivknltvfpenmkrnliysqrvllaeekitsrlspekiadcfdyny

SCOP Domain Coordinates for d1f1oa_:

Click to download the PDB-style file with coordinates for d1f1oa_.
(The format of our PDB-style files is described here.)

Timeline for d1f1oa_: