SCOPe 2.05: Domain d3ulda_: 3uld A:

Lineage for d3ulda_ (3uld A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein BH0863-like Ribonuclease H [142490] (3 species)
   new class of RNase H

7. Species Bacillus halodurans [TaxId:86665] [142491] (21 PDB entries)
   Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
   BH0863

8. Domain d3ulda_: 3uld A: [194320]
   automated match to d3ey1a_
   protein/DNA complex; protein/RNA complex; complexed with mg; mutant

Details for d3ulda_

PDB Entry: 3uld, 1.6 Å

PDB Description: high resolution structure of dna/rna hybrid in complex with rnase h catalytic domain d132n mutant

PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d3ulda_:

Sequence; same for both SEQRES and ATOM records:

>d3ulda_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikady

Timeline for d3ulda_:

• d3ulda_ first appeared in SCOPe 2.02
  
• d3ulda_ appears in SCOPe 2.04
  
• d3ulda_ appears in SCOPe 2.06
  
• d3ulda_ appears in the current release, SCOPe 2.08