Lineage for d1dofd_ (1dof D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6519Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 6520Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 6521Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 6522Protein Adenylosuccinate lyase [48568] (3 species)
  7. 6525Species Pyrobaculum aerophilum [TaxId:13773] [48570] (1 PDB entry)
  8. 6529Domain d1dofd_: 1dof D: [19432]

Details for d1dofd_

PDB Entry: 1dof (more details), 2.1 Å

PDB Description: the crystal structure of adenylosuccinate lyase from pyrobaculum aerophilum: insights into thermal stability and human pathology

SCOP Domain Sequences for d1dofd_:

Sequence, based on SEQRES records: (download)

>d1dofd_ a.127.1.1 (D:) Adenylosuccinate lyase {Pyrobaculum aerophilum}
hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
evyrleretghdilslvllleqksgcryvhygatsndiidtawallirralaavkekara
vgdqlasmarkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefiraki
ggavgtmaswgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferla
veirelsrpeigevveggggssamphkanptaserivslaryvralthvafenvalwher
dltnsanervwipeallaldeiltsalrvlknvyideeritenlqkalpyiltefhmnrm
ikegasraeaykkakevkaltfeyqkwpverliedalslklc

Sequence, based on observed residues (ATOM records): (download)

>d1dofd_ a.127.1.1 (D:) Adenylosuccinate lyase {Pyrobaculum aerophilum}
hvspfdwrygseeirrlftneaiinayleveralvcaleelgvaergccekvnkasvsad
evhdilslvllleqksgcryvhygatsndiidtawallirralaavkekaravgdqlasm
arkyktlemvgrthgqwaepitlgfkfanyyyelyiacrqlalaeefirakiggavgtma
swgelglevrrrvaerlglphhvittqvapresfavlasalalmaavferlaveirelsr
peigevvegganptaserivslaryvralthvafenvalwherdltnsanervwipeall
aldeiltsalrvlknvyideeritenlqkalpyiltefhmnrmikegasraeaykkakev
kaltfeyqkwpverliedalslklc

SCOP Domain Coordinates for d1dofd_:

Click to download the PDB-style file with coordinates for d1dofd_.
(The format of our PDB-style files is described here.)

Timeline for d1dofd_: