Lineage for d3unta_ (3unt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840113Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2840114Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 2840125Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2840154Species Zymomonas mobilis [TaxId:542] [51716] (156 PDB entries)
    Uniprot P28720
  8. 2840251Domain d3unta_: 3unt A: [194317]
    automated match to d1q2ra_
    complexed with dms, gol, zn; mutant

Details for d3unta_

PDB Entry: 3unt (more details), 1.8 Å

PDB Description: tRNA-guanine transglycosylase E339Q mutant
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d3unta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unta_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhliragqilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryfa

SCOPe Domain Coordinates for d3unta_:

Click to download the PDB-style file with coordinates for d3unta_.
(The format of our PDB-style files is described here.)

Timeline for d3unta_: