![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.9: CAF1-like ribonuclease [102492] (3 proteins) |
![]() | Protein automated matches [194311] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [194312] (1 PDB entry) |
![]() | Domain d4b8ab1: 4b8a B:7-283 [194313] Other proteins in same PDB: d4b8ab2 automated match to d1uoca_ |
PDB Entry: 4b8a (more details), 2.4 Å
SCOPe Domain Sequences for d4b8ab1:
Sequence, based on SEQRES records: (download)
>d4b8ab1 c.55.3.9 (B:7-283) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} flpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgtlarpigtfrskvdyhy qtmranvdflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslellrksgi nfekhenlgidvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnkedf ewwvhqympnfydlnlvykiiqefknpqlqqssqqqqqqqyslttladelglprfsiftt tggqsllmllsfcqlsklsmhkfpngtdfakyqgviy
>d4b8ab1 c.55.3.9 (B:7-283) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} flpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgtlarkvdyhyqtmranv dflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslginfekhenlgidvf efsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnkedfewwvhqympnfyd lnlvykiiqefknqyslttladelglprfsiftttggqsllmllsfcqlsklsmhkfpng tdfakyqgviy
Timeline for d4b8ab1: