Lineage for d4b8ab1 (4b8a B:7-283)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124786Family c.55.3.9: CAF1-like ribonuclease [102492] (3 protein domains)
  6. 2124794Protein automated matches [194311] (1 species)
    not a true protein
  7. 2124795Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [194312] (1 PDB entry)
  8. 2124796Domain d4b8ab1: 4b8a B:7-283 [194313]
    Other proteins in same PDB: d4b8ab2
    automated match to d1uoca_

Details for d4b8ab1

PDB Entry: 4b8a (more details), 2.4 Å

PDB Description: structure of yeast not1 mif4g domain co-crystallized with caf1
PDB Compounds: (B:) poly(a) ribonuclease pop2

SCOPe Domain Sequences for d4b8ab1:

Sequence, based on SEQRES records: (download)

>d4b8ab1 c.55.3.9 (B:7-283) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
flpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgtlarpigtfrskvdyhy
qtmranvdflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslellrksgi
nfekhenlgidvfefsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnkedf
ewwvhqympnfydlnlvykiiqefknpqlqqssqqqqqqqyslttladelglprfsiftt
tggqsllmllsfcqlsklsmhkfpngtdfakyqgviy

Sequence, based on observed residues (ATOM records): (download)

>d4b8ab1 c.55.3.9 (B:7-283) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
flpppnylfvrdvwksnlysefavirqlvsqynhvsistefvgtlarkvdyhyqtmranv
dflnpiqlglslsdangnkpdngpstwqfnfefdpkkeimsteslginfekhenlgidvf
efsqllmdsglmmddsvtwityhaaydlgflinilmndsmpnnkedfewwvhqympnfyd
lnlvykiiqefknqyslttladelglprfsiftttggqsllmllsfcqlsklsmhkfpng
tdfakyqgviy

SCOPe Domain Coordinates for d4b8ab1:

Click to download the PDB-style file with coordinates for d4b8ab1.
(The format of our PDB-style files is described here.)

Timeline for d4b8ab1: