SCOPe 2.05: Domain d4fp5f_: 4fp5 F:

Lineage for d4fp5f_ (4fp5 F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein automated matches [190381] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187229] (7 PDB entries)

8. Domain d4fp5f_: 4fp5 F: [194304]
   automated match to d1tiid_
   complexed with so4; mutant

Details for d4fp5f_

PDB Entry: 4fp5, 1.4 Å

PDB Description: heat-labile enterotoxin ilt-iibb5 s74a mutant

PDB Compounds: (F:) Heat-labile enterotoxin IIB, B chain

SCOPe Domain Sequences for d4fp5f_:

Sequence; same for both SEQRES and ATOM records:

>d4fp5f_ b.40.2.1 (F:) automated matches {Escherichia coli [TaxId: 562]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlagmrvnmcaspasspnviwaielea

Timeline for d4fp5f_:

• d4fp5f_ first appeared in SCOPe 2.02
  
• d4fp5f_ appears in SCOPe 2.04
  
• d4fp5f_ appears in SCOPe 2.06
  
• d4fp5f_ appears in the current release, SCOPe 2.08