Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (4 species) not a true protein |
Species Escherichia coli [TaxId:562] [187229] (4 PDB entries) |
Domain d4fp5f_: 4fp5 F: [194304] automated match to d1tiid_ complexed with so4; mutant |
PDB Entry: 4fp5 (more details), 1.4 Å
SCOPe Domain Sequences for d4fp5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fp5f_ b.40.2.1 (F:) automated matches {Escherichia coli [TaxId: 562]} gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm taemrkiamaavlagmrvnmcaspasspnviwaielea
Timeline for d4fp5f_:
View in 3D Domains from other chains: (mouse over for more information) d4fp5d_, d4fp5e_, d4fp5g_, d4fp5h_ |