Lineage for d4fp5h_ (4fp5 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788746Protein automated matches [190381] (11 species)
    not a true protein
  7. 2788786Species Escherichia coli [TaxId:562] [187229] (8 PDB entries)
  8. 2788811Domain d4fp5h_: 4fp5 H: [194302]
    automated match to d1tiid_
    complexed with so4; mutant

Details for d4fp5h_

PDB Entry: 4fp5 (more details), 1.4 Å

PDB Description: heat-labile enterotoxin ilt-iibb5 s74a mutant
PDB Compounds: (H:) Heat-labile enterotoxin IIB, B chain

SCOPe Domain Sequences for d4fp5h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fp5h_ b.40.2.1 (H:) automated matches {Escherichia coli [TaxId: 562]}
gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
taemrkiamaavlagmrvnmcaspasspnviwaielea

SCOPe Domain Coordinates for d4fp5h_:

Click to download the PDB-style file with coordinates for d4fp5h_.
(The format of our PDB-style files is described here.)

Timeline for d4fp5h_: