SCOPe 2.06: Domain d3uoub_: 3uou B:

Lineage for d3uoub_ (3uou B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (4 species)
   not a true protein

7. Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [189666] (4 PDB entries)

8. Domain d3uoub_: 3uou B: [194283]
   Other proteins in same PDB: d3uoua_
   automated match to d3m7qb_
   complexed with gol, so4; mutant

Details for d3uoub_

PDB Entry: 3uou, 2 Å

PDB Description: crystal structure of the kunitz-type protease inhibitor shpi-1 lys13leu mutant in complex with pancreatic elastase

PDB Compounds: (B:) Kunitz-type proteinase inhibitor SHPI-1

SCOPe Domain Sequences for d3uoub_:

Sequence; same for both SEQRES and ATOM records:

>d3uoub_ g.8.1.1 (B:) automated matches {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]}
sicsepkkvgrclgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicr

Timeline for d3uoub_:

• d3uoub_ first appeared in SCOPe 2.02
  
• d3uoub_ appears in SCOPe 2.05
  
• d3uoub_ appears in SCOPe 2.07
  
• d3uoub_ appears in the current release, SCOPe 2.08