Lineage for d3uoub_ (3uou B:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583928Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2583929Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2583930Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2584120Protein automated matches [190046] (3 species)
    not a true protein
  7. 2584164Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [189666] (4 PDB entries)
  8. 2584170Domain d3uoub_: 3uou B: [194283]
    Other proteins in same PDB: d3uoua_
    automated match to d3m7qb_
    complexed with gol, so4; mutant

Details for d3uoub_

PDB Entry: 3uou (more details), 2 Å

PDB Description: crystal structure of the kunitz-type protease inhibitor shpi-1 lys13leu mutant in complex with pancreatic elastase
PDB Compounds: (B:) Kunitz-type proteinase inhibitor SHPI-1

SCOPe Domain Sequences for d3uoub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uoub_ g.8.1.1 (B:) automated matches {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]}
sicsepkkvgrclgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicr

SCOPe Domain Coordinates for d3uoub_:

Click to download the PDB-style file with coordinates for d3uoub_.
(The format of our PDB-style files is described here.)

Timeline for d3uoub_: