Lineage for d1c3ub_ (1c3u B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6519Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 6520Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 6521Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 6522Protein Adenylosuccinate lyase [48568] (3 species)
  7. 6530Species Thermotoga maritima [TaxId:243274] [48569] (2 PDB entries)
  8. 6534Domain d1c3ub_: 1c3u B: [19428]

Details for d1c3ub_

PDB Entry: 1c3u (more details), 2.3 Å

PDB Description: t. maritima adenylosuccinate lyase

SCOP Domain Sequences for d1c3ub_:

Sequence, based on SEQRES records: (download)

>d1c3ub_ a.127.1.1 (B:) Adenylosuccinate lyase {Thermotoga maritima}
veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
hlqrtevleveepfrkgqrgssamphkknpitcerltglsrmmrayvdpslenialwher
dishssveryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkl
iekgltrkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhv
dhiferfek

Sequence, based on observed residues (ATOM records): (download)

>d1c3ub_ a.127.1.1 (B:) Adenylosuccinate lyase {Thermotoga maritima}
veryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkk
ieektnhdvvafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefc
dvlwevanrykhtptigrthgvhaeptsfglkvlgwysemkrnvqrleraieevsygkis
gavgnyanvppeveekalsylglkpepvstqvvprdrhafylstlaivaagieriaveir
hlqrtevleveepfrsamphkknpitcerltglsrmmrayvdpslenialwherdishss
veryvfpdatqtlyymivtatnvvrnmkvneermkknidltkglvfsqrvllkliekglt
rkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdisyylkhvdhifer
fek

SCOP Domain Coordinates for d1c3ub_:

Click to download the PDB-style file with coordinates for d1c3ub_.
(The format of our PDB-style files is described here.)

Timeline for d1c3ub_: