Lineage for d4b0ia_ (4b0i A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943682Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 2943693Protein automated matches [191220] (4 species)
    not a true protein
  7. 2943694Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193354] (7 PDB entries)
  8. 2943697Domain d4b0ia_: 4b0i A: [194270]
    automated match to d1mkaa_
    complexed with kbp; mutant

Details for d4b0ia_

PDB Entry: 4b0i (more details), 2.03 Å

PDB Description: Crystal Structure of 3-hydroxydecanoyl-Acyl Carrier Protein Dehydratase (FabA) mutant (H70N) from Pseudomonas aeruginosa in complex with 3-hydroxydecanoyl-N-acetyl cysteamine
PDB Compounds: (A:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d4b0ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4b0ia_ d.38.1.2 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin
pdlwffacnfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta
kkvtynihikrtinrslvlaiadgtvsvdgreiysaeglrvglftstd

SCOPe Domain Coordinates for d4b0ia_:

Click to download the PDB-style file with coordinates for d4b0ia_.
(The format of our PDB-style files is described here.)

Timeline for d4b0ia_: