![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins) contains two additional beta-strands in the N-terminal extension |
![]() | Protein automated matches [191220] (4 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [193354] (7 PDB entries) |
![]() | Domain d4b0ic_: 4b0i C: [194269] automated match to d1mkaa_ complexed with kbp; mutant |
PDB Entry: 4b0i (more details), 2.03 Å
SCOPe Domain Sequences for d4b0ic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4b0ic_ d.38.1.2 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} tkqhaftredllrcsrgelfgpgnaqlpapnmlmidrivhisdvggkygkgelvaeldin pdlwffacnfegdpvmpgclgldamwqlvgfylgwqgnpgrgralgsgevkffgqvlpta kkvtynihikrtinrslvlaiadgtvsvdgreiysaeglrvglftstdsf
Timeline for d4b0ic_:
![]() Domains from other chains: (mouse over for more information) d4b0ia_, d4b0ib_, d4b0id_, d4b0ie_ |