Lineage for d4hsha_ (4hsh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089551Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2089552Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 protein domains)
  6. 2089563Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2089569Species Zymomonas mobilis [TaxId:264203] [224878] (22 PDB entries)
  8. 2089576Domain d4hsha_: 4hsh A: [194268]
    automated match to d1q2ra_
    protein/RNA complex; complexed with gol, qei, zn; mutant

Details for d4hsha_

PDB Entry: 4hsh (more details), 1.56 Å

PDB Description: tRNA-guanine transglycosylase Y106F, V233G mutant in complex with queuine
PDB Compounds: (A:) Queuine tRNA-ribosyltransferase

SCOPe Domain Sequences for d4hsha_:

Sequence, based on SEQRES records: (download)

>d4hsha_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 264203]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggfqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglaggegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryfa

Sequence, based on observed residues (ATOM records): (download)

>d4hsha_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 264203]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggfqvmstkqseegvtfkshrhmlspe
rsieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrkeqaenaal
fgiqqgsvfenlrqqsadalaeigfdgyavgglaggegqdemfrvldfsvpmlpddkphy
lmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsedlkpldsec
hcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrfsqfaqdfr
aryfa

SCOPe Domain Coordinates for d4hsha_:

Click to download the PDB-style file with coordinates for d4hsha_.
(The format of our PDB-style files is described here.)

Timeline for d4hsha_: