Lineage for d4hwga1 (4hwg A:1-376)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142581Species Rickettsia bellii [TaxId:336407] [194265] (1 PDB entry)
  8. 2142582Domain d4hwga1: 4hwg A:1-376 [194266]
    Other proteins in same PDB: d4hwga2
    automated match to d1o6cb_
    complexed with po4

Details for d4hwga1

PDB Entry: 4hwg (more details), 2 Å

PDB Description: Structure of UDP-N-acetylglucosamine 2-epimerase from Rickettsia bellii
PDB Compounds: (A:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d4hwga1:

Sequence, based on SEQRES records: (download)

>d4hwga1 c.87.1.0 (A:1-376) automated matches {Rickettsia bellii [TaxId: 336407]}
mlkvmtivgtrpeliklccvisefdkhtkhilvhtgqnyayelnqvffddmgirkpdyfl
evaadntaksiglviekvdevlekekpdavlfygdtnsclsaiaakrrkipifhmeagnr
cfdqrvpeeinrkiidhisdvnitlteharryliaeglpaeltfksgshmpevldrfmpk
ilksdildklsltpkqyflisshreenvdvknnlkellnslqmlikeynfliifsthprt
kkrledlegfkelgdkirflpafsftdyvklqmnafcilsdsgtiteeasilnlpalnir
eaherpegmdagtlimsgfkaervlqavktiteehdnnkrtqglvpdyneaglvskkilr
ivlsyvdyinrtvwfk

Sequence, based on observed residues (ATOM records): (download)

>d4hwga1 c.87.1.0 (A:1-376) automated matches {Rickettsia bellii [TaxId: 336407]}
mlkvmtivgtrpeliklccvisefdkhtkhilvhtgqnyayelnqvffdmgirkpdyfle
vaadntaksiglviekvdevlekekpdavlfygdtnsclsaiaakrrkipifhmeagnrc
fdqrvpeeinrkiidhisdvnitlteharryliaeglpaeltfksgshmpevldrfmpki
lksdildklsltpkqyflisshreknnlkellnslqmlikeynfliifsthprtkkrled
legfkelgdkirflpafsftdyvklqmnafcilsdsgtiteeasilnlpalnireaherp
egmdagtlimsgfkaervlqavktiteehdnnkrtqglvpdyneaglvskkilrivlsyv
dyinrtvwfk

SCOPe Domain Coordinates for d4hwga1:

Click to download the PDB-style file with coordinates for d4hwga1.
(The format of our PDB-style files is described here.)

Timeline for d4hwga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hwga2