![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
![]() | Protein automated matches [191113] (4 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:203119] [194259] (1 PDB entry) |
![]() | Domain d3ul4a_: 3ul4 A: [194260] Other proteins in same PDB: d3ul4b_ automated match to d1aohb_ complexed with ca, peg, so4 |
PDB Entry: 3ul4 (more details), 1.95 Å
SCOPe Domain Sequences for d3ul4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ul4a_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]} ntieiiignvkarpgdrievpvslknvpdkgivssdfvieydsklfkvielkagdivenp sesfsynvvekdeiiavlyleetglgieairtdgvfftivmevskdvkpgispikfesfg atadndmnemtpklvegkveii
Timeline for d3ul4a_: