Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins) structural evidence for the gene duplication within the barrel fold automatically mapped to Pfam PF00977 |
Protein automated matches [190186] (10 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [186925] (4 PDB entries) |
Domain d4ewnd_: 4ewn D: [194252] automated match to d1thfd_ complexed with 0vr |
PDB Entry: 4ewn (more details), 1.9 Å
SCOPe Domain Sequences for d4ewnd_:
Sequence, based on SEQRES records: (download)
>d4ewnd_ c.1.2.1 (D:) automated matches {Thermotoga maritima [TaxId: 2336]} lakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrkt mlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfg sqavvvaivakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrvgtksg ydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeyl kkhgvnvrl
>d4ewnd_ c.1.2.1 (D:) automated matches {Thermotoga maritima [TaxId: 2336]} lakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditktmlelve kvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfgsqavvv aivakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrvgtksgydtemi rfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeylkkhgvn vrl
Timeline for d4ewnd_: