Lineage for d4ewnd_ (4ewn D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079054Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 protein domains)
    structural evidence for the gene duplication within the barrel fold
    automatically mapped to Pfam PF00977
  6. 2079090Protein automated matches [190186] (10 species)
    not a true protein
  7. 2079117Species Thermotoga maritima [TaxId:2336] [186925] (4 PDB entries)
  8. 2079119Domain d4ewnd_: 4ewn D: [194252]
    automated match to d1thfd_
    complexed with 0vr

Details for d4ewnd_

PDB Entry: 4ewn (more details), 1.9 Å

PDB Description: Structure of HisF-D130V+D176V with bound rCdRP
PDB Compounds: (D:) Imidazole glycerol phosphate synthase subunit hisF

SCOPe Domain Sequences for d4ewnd_:

Sequence, based on SEQRES records: (download)

>d4ewnd_ c.1.2.1 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
lakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrkt
mlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfg
sqavvvaivakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrvgtksg
ydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeyl
kkhgvnvrl

Sequence, based on observed residues (ATOM records): (download)

>d4ewnd_ c.1.2.1 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
lakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditktmlelve
kvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfgsqavvv
aivakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrvgtksgydtemi
rfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeylkkhgvn
vrl

SCOPe Domain Coordinates for d4ewnd_:

Click to download the PDB-style file with coordinates for d4ewnd_.
(The format of our PDB-style files is described here.)

Timeline for d4ewnd_: