![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.1: Zinc protease [55487] (2 proteins) single domain automatically mapped to Pfam PF02031 |
![]() | Protein automated matches [194246] (1 species) not a true protein |
![]() | Species Streptomyces caespitosus [TaxId:53502] [194247] (1 PDB entry) |
![]() | Domain d4hx3k1: 4hx3 K:1-132 [194248] Other proteins in same PDB: d4hx3a2, d4hx3b_, d4hx3c2, d4hx3d_, d4hx3e2, d4hx3f_, d4hx3g2, d4hx3h1, d4hx3h2, d4hx3i2, d4hx3j_, d4hx3k2, d4hx3l_ automated match to d1c7ka_ complexed with gol, zn |
PDB Entry: 4hx3 (more details), 2.7 Å
SCOPe Domain Sequences for d4hx3k1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx3k1 d.92.1.1 (K:1-132) automated matches {Streptomyces caespitosus [TaxId: 53502]} mvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq ersrvnalwang
Timeline for d4hx3k1: