Lineage for d4a47d_ (4a47 D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417028Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1417029Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1417123Protein automated matches [190409] (4 species)
    not a true protein
  7. 1417139Species Synechocystis sp. [TaxId:1148] [194236] (1 PDB entry)
  8. 1417143Domain d4a47d_: 4a47 D: [194240]
    automated match to d1sb6a_
    complexed with zn

Details for d4a47d_

PDB Entry: 4a47 (more details), 1.9 Å

PDB Description: Crosstalk between Cu(I) and Zn(II) homeostasis
PDB Compounds: (D:) uncharacterized protein ssr2857

SCOPe Domain Sequences for d4a47d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a47d_ d.58.17.1 (D:) automated matches {Synechocystis sp. [TaxId: 1148]}
tiqltvptmdctscaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasagh
eve

SCOPe Domain Coordinates for d4a47d_:

Click to download the PDB-style file with coordinates for d4a47d_.
(The format of our PDB-style files is described here.)

Timeline for d4a47d_: