Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
Protein automated matches [190409] (4 species) not a true protein |
Species Synechocystis sp. [TaxId:1148] [194236] (1 PDB entry) |
Domain d4a47b_: 4a47 B: [194239] automated match to d1sb6a_ complexed with zn |
PDB Entry: 4a47 (more details), 1.9 Å
SCOPe Domain Sequences for d4a47b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a47b_ d.58.17.1 (B:) automated matches {Synechocystis sp. [TaxId: 1148]} tiqltvptmdctscaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasagh eve
Timeline for d4a47b_: