Lineage for d4a47b_ (4a47 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2953869Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2953988Protein automated matches [190409] (5 species)
    not a true protein
  7. 2954013Species Synechocystis sp. [TaxId:1148] [194236] (1 PDB entry)
  8. 2954015Domain d4a47b_: 4a47 B: [194239]
    automated match to d1sb6a_
    complexed with zn

Details for d4a47b_

PDB Entry: 4a47 (more details), 1.9 Å

PDB Description: Crosstalk between Cu(I) and Zn(II) homeostasis
PDB Compounds: (B:) ssr2857 protein

SCOPe Domain Sequences for d4a47b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a47b_ d.58.17.1 (B:) automated matches {Synechocystis sp. [TaxId: 1148]}
tiqltvptmdctscaeavtkavqnedaqatvqvdltskkvtitsalgeeqlrtaiasagh
eve

SCOPe Domain Coordinates for d4a47b_:

Click to download the PDB-style file with coordinates for d4a47b_.
(The format of our PDB-style files is described here.)

Timeline for d4a47b_: