Lineage for d4hpka_ (4hpk A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039933Family b.18.1.36: Collagen-binding domain [267607] (1 protein)
    PubMed 17977833 describes likely homology between (d2quoa_), (d1w99a3), and (d1nqdb_)
  6. 2039934Protein Class 1 collagenase [267633] (1 species)
  7. 2039935Species Clostridium histolyticum [TaxId:1498] [267693] (5 PDB entries)
  8. 2039940Domain d4hpka_: 4hpk A: [194231]
    automated match to d1nqda_
    complexed with ca, cl, no3

Details for d4hpka_

PDB Entry: 4hpk (more details), 1.35 Å

PDB Description: Crystal structure of Clostridium histolyticum colg collagenase collagen-binding domain 3B at 1.35 Angstrom resolution in presence of calcium nitrate
PDB Compounds: (A:) collagenase

SCOPe Domain Sequences for d4hpka_:

Sequence, based on SEQRES records: (download)

>d4hpka_ b.18.1.36 (A:) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
klkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkdefgvt
wtlhpesnindritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk

Sequence, based on observed residues (ATOM records): (download)

>d4hpka_ b.18.1.36 (A:) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
klkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkdefgvt
wtlhpesdritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk

SCOPe Domain Coordinates for d4hpka_:

Click to download the PDB-style file with coordinates for d4hpka_.
(The format of our PDB-style files is described here.)

Timeline for d4hpka_: