SCOPe 2.08: Domain d4hpkb_: 4hpk B:

Lineage for d4hpkb_ (4hpk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.36: Collagen-binding domain [267607] (1 protein)
   PubMed 17977833 describes likely homology between (d2quoa_), (d1w99a3), and (d1nqdb_)

6. Protein Class 1 collagenase [267633] (1 species)

7. Species Clostridium histolyticum [TaxId:1498] [267693] (5 PDB entries)

8. Domain d4hpkb_: 4hpk B: [194230]
   automated match to d2o8ob_
   complexed with ca, cl, no3

Details for d4hpkb_

PDB Entry: 4hpk, 1.35 Å

PDB Description: Crystal structure of Clostridium histolyticum colg collagenase collagen-binding domain 3B at 1.35 Angstrom resolution in presence of calcium nitrate

PDB Compounds: (B:) collagenase

SCOPe Domain Sequences for d4hpkb_:

Sequence, based on SEQRES records:

>d4hpkb_ b.18.1.36 (B:) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
ipgneklkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkd
efgvtwtlhpesnindritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk

Sequence, based on observed residues (ATOM records):

>d4hpkb_ b.18.1.36 (B:) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
ipgneklkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkd
efgvtwtlhpesitygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk

Timeline for d4hpkb_:

• d4hpkb_ first appeared in SCOPe 2.02
  
• d4hpkb_ appears in SCOPe 2.07