Lineage for d1dcnd_ (1dcn D:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101198Fold a.127: L-aspartase-like [48556] (1 superfamily)
  4. 101199Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 101200Family a.127.1.1: L-aspartase/fumarase [48558] (4 proteins)
  6. 101214Protein Argininosuccinate lyase/delta-crystallin [48564] (3 species)
  7. 101215Species Domestic duck (Anas platyrhynchos), delta-crystallin [TaxId:8839] [48566] (4 PDB entries)
  8. 101225Domain d1dcnd_: 1dcn D: [19423]

Details for d1dcnd_

PDB Entry: 1dcn (more details), 2.3 Å

PDB Description: inactive mutant h162n of delta 2 crystallin with bound argininosuccinate

SCOP Domain Sequences for d1dcnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcnd_ a.127.1.1 (D:) Argininosuccinate lyase/delta-crystallin {Domestic duck (Anas platyrhynchos), delta-crystallin}
pimaklnssiaydqrlsevdiqgsmayakalekagiltktelakilsglekiseewskgv
fvvkgsdedihtanerrlkeligdiagklntgrsrndqvvtdlklfmknslsiisthllq
liktlveraaieidvilpgytnlqkaqpirwsqfllshavaltrdserlgevkkrinvlp
lgsgalagnpldidremlrselefasislnsmdaiserdfvveflsfatllmihlskmae
dliiystsefgfltlsdafstnpdslelirsksgrvfgrlasilmvlkglpstynkdlqe
dkeavfdvvdtltavlqvatgvistlqiskenmekaltpemlatdlalylvrkgvpfrqa
htasgkavhlaetkgitinnlsledlksispqfssdvsqvfnfvnsveqytalggtakss
vttqieqlrelmkkqk

SCOP Domain Coordinates for d1dcnd_:

Click to download the PDB-style file with coordinates for d1dcnd_.
(The format of our PDB-style files is described here.)

Timeline for d1dcnd_: