SCOPe 2.05: Domain d4hz1b_: 4hz1 B:

Lineage for d4hz1b_ (4hz1 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (87 PDB entries)
   Uniprot P00282

8. Domain d4hz1b_: 4hz1 B: [194228]
   automated match to d1jzga_
   complexed with act, fe2

Details for d4hz1b_

PDB Entry: 4hz1, 2.2 Å

PDB Description: Crystal Structure of Pseudomonas aeruginosa azurin with iron(II) at the copper-binding site.

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d4hz1b_:

Sequence; same for both SEQRES and ATOM records:

>d4hz1b_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltl

Timeline for d4hz1b_:

• d4hz1b_ first appeared in SCOPe 2.02
  
• d4hz1b_ appears in SCOPe 2.04
  
• d4hz1b_ appears in SCOPe 2.06
  
• d4hz1b_ appears in the current release, SCOPe 2.08