Lineage for d3uffb_ (3uff B:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1465231Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1465232Superfamily g.49.1: Cysteine-rich domain [57889] (3 families) (S)
  5. 1465233Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 1465256Protein automated matches [193184] (1 species)
    not a true protein
  7. 1465257Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries)
  8. 1465261Domain d3uffb_: 3uff B: [194224]
    automated match to d1ptqa_
    complexed with po4, zn

Details for d3uffb_

PDB Entry: 3uff (more details), 1.3 Å

PDB Description: structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase cdelta
PDB Compounds: (B:) protein kinase c delta type

SCOPe Domain Sequences for d3uffb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uffb_ g.49.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gsrrasvgshrfkvtnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlce
fivtd

SCOPe Domain Coordinates for d3uffb_:

Click to download the PDB-style file with coordinates for d3uffb_.
(The format of our PDB-style files is described here.)

Timeline for d3uffb_: