Class g: Small proteins [56992] (94 folds) |
Fold g.49: Cysteine-rich domain [57888] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) |
Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins) Pfam PF00130 |
Protein automated matches [193184] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries) |
Domain d3ugdb1: 3ugd B:231-280 [194223] Other proteins in same PDB: d3ugda2, d3ugda3, d3ugdb2, d3ugdb3 automated match to d1ptqa_ complexed with edo, po4, zn |
PDB Entry: 3ugd (more details), 1.45 Å
SCOPe Domain Sequences for d3ugdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ugdb1 g.49.1.1 (B:231-280) automated matches {Mouse (Mus musculus) [TaxId: 10090]} hrfkvhnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc
Timeline for d3ugdb1: