Lineage for d3ugdb1 (3ugd B:231-280)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264294Fold g.49: Cysteine-rich domain [57888] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 2264295Superfamily g.49.1: Cysteine-rich domain [57889] (4 families) (S)
  5. 2264296Family g.49.1.1: Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) [57890] (7 proteins)
    Pfam PF00130
  6. 2264319Protein automated matches [193184] (2 species)
    not a true protein
  7. 2264322Species Mouse (Mus musculus) [TaxId:10090] [193185] (7 PDB entries)
  8. 2264334Domain d3ugdb1: 3ugd B:231-280 [194223]
    Other proteins in same PDB: d3ugda2, d3ugda3, d3ugdb2, d3ugdb3
    automated match to d1ptqa_
    complexed with edo, po4, zn

Details for d3ugdb1

PDB Entry: 3ugd (more details), 1.45 Å

PDB Description: structural and functional characterization of an anesthetic binding site in the second cysteine-rich domain of protein kinase c delta
PDB Compounds: (B:) protein kinase c delta type

SCOPe Domain Sequences for d3ugdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ugdb1 g.49.1.1 (B:231-280) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hrfkvhnymsptfcdhcgsllwglvkqglkcedcgmnvhhkcrekvanlc

SCOPe Domain Coordinates for d3ugdb1:

Click to download the PDB-style file with coordinates for d3ugdb1.
(The format of our PDB-style files is described here.)

Timeline for d3ugdb1: