Lineage for d3v13a_ (3v13 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405549Protein Trypsin(ogen) [50515] (9 species)
  7. 2405567Species Cow (Bos taurus) [TaxId:9913] [50516] (494 PDB entries)
    Uniprot P00760
  8. 2405802Domain d3v13a_: 3v13 A: [194222]
    automated match to d3pwca_
    complexed with 3yh, ca, cl, gol, imd, so4

Details for d3v13a_

PDB Entry: 3v13 (more details), 1.63 Å

PDB Description: Bovine trypsin variant X(tripleGlu217Phe227) in complex with small molecule inhibitor
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3v13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v13a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcvgyleggkdacqgdsggp
vvcsgklqgivswgegcaqknkpgfytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d3v13a_:

Click to download the PDB-style file with coordinates for d3v13a_.
(The format of our PDB-style files is described here.)

Timeline for d3v13a_: