SCOPe 2.05: Domain d4fn6c_: 4fn6 C:

Lineage for d4fn6c_ (4fn6 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (8 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [194218] (1 PDB entry)

8. Domain d4fn6c_: 4fn6 C: [194220]
   automated match to d3no6b_
   complexed with act, gol

Details for d4fn6c_

PDB Entry: 4fn6, 2.69 Å

PDB Description: Structural Characterization of Thiaminase type II TenA from Staphylococcus aureus

PDB Compounds: (C:) thiaminase-2

SCOPe Domain Sequences for d4fn6c_:

Sequence; same for both SEQRES and ATOM records:

>d4fn6c_ a.132.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 282458]}
mefsqklyqaakpiindiyeddfiqkmllgniqadalrhylqadaaylkeftnlyallip
kmnsmndvkflveqiefmvegevlahdilaqivgesyeeiiktkvwppsgdhyikhmyfq
ahsrenaiytiaamapcpyiyaelakrsqsdhklnrekdtakwfdfystemddiinvfes
lmnklaesmsdkeleqvkqvflesciherrffnmamtleqwefg

Timeline for d4fn6c_:

• d4fn6c_ first appeared in SCOPe 2.02
  
• d4fn6c_ appears in SCOPe 2.04
  
• d4fn6c_ appears in SCOPe 2.06
  
• d4fn6c_ appears in the current release, SCOPe 2.08